PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.07G054800.1.p
Common NameGLYMA_07G054800, LOC100790981
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family ARF
Protein Properties Length: 717aa    MW: 79530.4 Da    PI: 6.4593
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.07G054800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B373.72.2e-23133233198
                          EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEE CS
                   B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFk 83 
                          f+k+lt sd++++g +++ +k+a+e+       +  ++ +++l  +d++g +W++k+iyr++++r++lt+GW+ Fv +++L +gD +vF 
  Glyma.07G054800.1.p 133 FCKILTASDTSTHGGFSVLRKHATEClpeldmtQ--STPTQELAAKDLHGFEWKFKHIYRGQPRRHLLTTGWSTFVASKRLVAGDAFVFL 220
                          99**************************999644..444569************************************************ PP

                          E-SSSEE..EEEEE- CS
                   B3  84 ldgrsefelvvkvfr 98 
                            + + ++l+v+v+r
  Glyma.07G054800.1.p 221 --RGEHGQLRVGVRR 233
                          ..4489999****98 PP

2Auxin_resp97.22.4e-32259338183
           Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                          a+ha+ t+++F v+Y+Pr+  s+F+v ++k+++a+++k+s+ mRfkm+fe++ds+err+sGt+vgv d++   W+nS+WrsLk
  Glyma.07G054800.1.p 259 ASHAVMTRTMFLVYYKPRT--SQFIVGLNKYLEAVNNKFSLSMRFKMRFEGDDSPERRFSGTIVGVGDVSA-GWSNSQWRSLK 338
                          689***************6..9**********************************************777.*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019364.58E-41123262IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.9E-40124248IPR015300DNA-binding pseudobarrel domain
CDDcd100174.96E-19131233No hitNo description
PROSITE profilePS5086311.589133235IPR003340B3 DNA binding domain
PfamPF023622.8E-21133233IPR003340B3 DNA binding domain
SMARTSM010198.8E-21133235IPR003340B3 DNA binding domain
PfamPF065071.0E-30259338IPR010525Auxin response factor
PfamPF023091.7E-9587678IPR033389AUX/IAA domain
SuperFamilySSF542774.05E-12590672No hitNo description
PROSITE profilePS5174525.929596677IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 717 aa     Download sequence    Send to blast
MAHLECNLGG PGSSGTSQPE KGLKDDDLYR ELWKLCAGPL VDVPRNGDRV FYFPQGHMEQ  60
LQASTDQELN QEIPHFNLPA KIFCRVVNIQ LLAEQDTDEV YACIALLPES DQTEPTNPDP  120
NVSEAPKQKF HSFCKILTAS DTSTHGGFSV LRKHATECLP ELDMTQSTPT QELAAKDLHG  180
FEWKFKHIYR GQPRRHLLTT GWSTFVASKR LVAGDAFVFL RGEHGQLRVG VRRLARQQSP  240
MPSSVISSQS MHLGVLATAS HAVMTRTMFL VYYKPRTSQF IVGLNKYLEA VNNKFSLSMR  300
FKMRFEGDDS PERRFSGTIV GVGDVSAGWS NSQWRSLKVQ WDEPATIPRP DRVSCWEIEP  360
FVASTALNVT QPAVKGKRSR PADVLSSAAS GFWYHGSSNE LSQLGAAAEV QSKENQVVPC  420
SLRQKDIINS NPINANNSSI STRVRMEGVW PSSPHLNATP NLFSDPNNNN SNNGVSARSL  480
ISGYPNVPSR SSDGPTCDGV EDGKKTENSL DCWLFGVNLT NNCSNVITTP SEREQRGPSS  540
SVVLSGPKES IPAAACETER VQTPNYSLSN KGQKQIISEA SPNQWQNKQA TVLSMRTRTK  600
VQMQGVAVGR AFDLTTLSGY DDLIDELEKL FEIRGELRSQ DKWAVTFTDD ENDMMLAGDD  660
PWPEFCNMVK RIFICSREDL KKMKCCKLPA SSSEVEEILL SPDSQNRDET QQSHMP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldw_B1e-1692236113355Auxin response factor 1
4ldw_A1e-1692236113355Auxin response factor 1
4ldv_A1e-1692236113355Auxin response factor 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.277380.0leaf
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). {ECO:0000256|RuleBase:RU004561}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006583221.10.0PREDICTED: auxin response factor 18-like isoform X1
SwissprotQ9C5W90.0ARFR_ARATH; Auxin response factor 18
TrEMBLK7KZU20.0K7KZU2_SOYBN; Auxin response factor
STRINGGLYMA07G06060.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15113396
Representative plantOGRP5501582
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G59750.30.0auxin response factor 1